Loading...
Statistics
Advertisement

The Wallpapers - The Best Wallpapers the World
www.thewallpapers.info/
The Best Wallpapers the World

Thewallpapers.info

Advertisement
Conversion Technology Metas Server
Thewallpapers.info is hosted in United States / Orlando . Thewallpapers.info uses HTTPS protocol. Number of used technologies: 7. First technologies: CSS, Html, Html5, Number of used javascripts: 6. First javascripts: Jquery.js, Jquery-migrate.min.js, Jquery.form.min.js, Number of used analytics tools: 1. First analytics tools: Histats, Number of used plugins, modules: 1. Its server type is: LiteSpeed. Its CMS is: Wordpress.

Technologies in use by Thewallpapers.info

Technology

Number of occurences: 7
  • CSS
  • Html
  • Html5
  • Javascript
  • jQuery
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 6
  • jquery.js
  • jquery-migrate.min.js
  • jquery.form.min.js
  • scripts.js
  • js-mainmenu.js
  • wp-embed.min.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • Histats

Server Type

  • LiteSpeed

Used plugins, modules

Number of plugins and modules: 1
  • contact form 7

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Thewallpapers.info

SSL certificate

    • name: /CN=thewallpapers.info
    • subject:
      • CN: thewallpapers.info
    • hash: e817288c
    • issuer:
      • C: US
      • ST: TX
      • L: Houston
      • O: cPanel, Inc.
      • CN: cPanel, Inc. Certification Authority
    • version: 2
    • serialNumber: 23259837158288399728161175347931218796
    • validFrom: 160825000000Z
    • validTo: 161123235959Z
    • validFrom_time_t: 1472083200
    • validTo_time_t: 1479945599
    • extensions:
      • authorityKeyIdentifier: keyid:7E:03:5A:65:41:6B:A7:7E:0A:E1:B8:9D:08:EA:1D:8E:1D:6A:C7:65
      • subjectKeyIdentifier: E7:AE:E8:0D:AB:71:6A:71:EA:B1:F7:1F:61:5E:B2:A8:54:D4:E2:03
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.52 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/cPanelIncCertificationAuthority.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/cPanelIncCertificationAuthority.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:thewallpapers.info, DNS:www.thewallpapers.info

Meta - Thewallpapers.info

Number of occurences: 9
  • Name:
    Content: The Wallpapers
  • Name: viewport
    Content: width=device-width, initial-scale=1.0
  • Name: description
    Content: The Best Wallpapers the World
  • Name: robots
    Content: noodp
  • Name: twitter:card
    Content: summary
  • Name: twitter:description
    Content: The Best Wallpapers the World
  • Name: twitter:title
    Content: The Wallpapers - The Best Wallpapers the World
  • Name: google-site-verification
    Content: uayR7SGmQNHfzy0U3rX6ZfHBjdHWrnlJgw3KaEm0gOc
  • Name: generator
    Content: WordPress 4.5.3

Server / Hosting

  • IP: 138.128.172.223
  • Latitude: 28.59
  • Longitude: -81.19
  • Country: United States
  • City: Orlando

Rname

  • ns2.zandmedia.com
  • ns1.zandmedia.com
  • thewallpapers.info

Target

  • riyanto.argo.gmail.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Content-Type: text/html; charset=UTF-8 Location: http://thewallpapers.info/ Content-Length: 0 Date: Wed, 31 Aug 2016 17:00:15 GMT Accept-Ranges: bytes Server: LiteSpeed X-Frame-Options: SAMEORIGIN X-Cache: MISS from s_mf40 X-Cache-Lookup: MISS from s_mf40:80 Via: 1.1 s_mf40 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 OK Content-Type: text/html; charset=UTF-8 Link: ; rel="https://api.w.org/" Date: Wed, 31 Aug 2016 17:00:16 GMT Accept-Ranges: bytes Server: LiteSpeed X-Frame-Options: SAMEORIGIN X-Cache: MISS from s_mf40 X-Cache-Lookup: MISS from s_mf40:80 Transfer-Encoding: chunked Via: 1.1 s_mf40 (squid/3.5.20) Connection: keep-alive

DNS

host: thewallpapers.info
  1. class: IN
  2. ttl: 14397
  3. type: A
  4. ip: 138.128.172.223
host: thewallpapers.info
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.zandmedia.com
host: thewallpapers.info
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.zandmedia.com
host: thewallpapers.info
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.zandmedia.com
  5. rname: riyanto.argo.gmail.com
  6. serial: 2016050603
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 86400
host: thewallpapers.info
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: thewallpapers.info
host: thewallpapers.info
  1. class: IN
  2. ttl: 14400
  3. type: TXT
  4. txt: v=spf1 +a +mx +ip4:138.128.172.194 ~all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.hewallpapers.info, www.tqhewallpapers.info, www.qhewallpapers.info, www.tahewallpapers.info, www.ahewallpapers.info, www.t hewallpapers.info, www. hewallpapers.info, www.twhewallpapers.info, www.whewallpapers.info, www.tehewallpapers.info, www.ehewallpapers.info, www.tzhewallpapers.info, www.zhewallpapers.info, www.txhewallpapers.info, www.xhewallpapers.info, www.tchewallpapers.info, www.chewallpapers.info, www.tewallpapers.info, www.theewallpapers.info, www.teewallpapers.info, www.thdewallpapers.info, www.tdewallpapers.info, www.thcewallpapers.info, www.tcewallpapers.info, www.thuewallpapers.info, www.tuewallpapers.info, www.thjewallpapers.info, www.tjewallpapers.info, www.thewallpapers.info, www.tewallpapers.info, www.thbewallpapers.info, www.tbewallpapers.info, www.thgewallpapers.info, www.tgewallpapers.info, www.thwallpapers.info, www.thexwallpapers.info, www.thxwallpapers.info, www.theswallpapers.info, www.thswallpapers.info, www.thewwallpapers.info, www.thwwallpapers.info, www.therwallpapers.info, www.thrwallpapers.info, www.thefwallpapers.info, www.thfwallpapers.info, www.thevwallpapers.info, www.thvwallpapers.info, www.thecwallpapers.info, www.thcwallpapers.info, www.theqwallpapers.info, www.thqwallpapers.info, www.theawallpapers.info, www.thawallpapers.info, www.theywallpapers.info, www.thywallpapers.info, www.theallpapers.info, www.thew allpapers.info, www.the allpapers.info, www.thewcallpapers.info, www.thecallpapers.info, www.thewallpapers.info, www.theallpapers.info, www.thewdallpapers.info, www.thedallpapers.info, www.thewfallpapers.info, www.thefallpapers.info, www.thewgallpapers.info, www.thegallpapers.info, www.thewballpapers.info, www.theballpapers.info, www.thewllpapers.info, www.thewaollpapers.info, www.thewollpapers.info, www.thewapllpapers.info, www.thewpllpapers.info, www.thewa9llpapers.info, www.thew9llpapers.info, www.thewallpapers.info, www.thewllpapers.info, www.thewaillpapers.info, www.thewillpapers.info, www.thewaullpapers.info, www.thewullpapers.info, www.thewalpapers.info, www.thewalulpapers.info, www.thewaulpapers.info, www.thewal8lpapers.info, www.thewa8lpapers.info, www.thewal9lpapers.info, www.thewa9lpapers.info, www.thewaljlpapers.info, www.thewajlpapers.info, www.thewal0lpapers.info, www.thewa0lpapers.info, www.thewalmlpapers.info, www.thewamlpapers.info, www.thewalplpapers.info, www.thewaplpapers.info, www.thewalolpapers.info, www.thewaolpapers.info, www.thewalpapers.info, www.thewallupapers.info, www.thewalupapers.info, www.thewall8papers.info, www.thewal8papers.info, www.thewall9papers.info, www.thewal9papers.info, www.thewalljpapers.info, www.thewaljpapers.info, www.thewall0papers.info, www.thewal0papers.info, www.thewallmpapers.info, www.thewalmpapers.info, www.thewallppapers.info, www.thewalppapers.info, www.thewallopapers.info, www.thewalopapers.info, www.thewallapers.info, www.thewallpiapers.info, www.thewalliapers.info, www.thewallpkapers.info, www.thewallkapers.info, www.thewallpuapers.info, www.thewalluapers.info, www.thewallpjapers.info, www.thewalljapers.info, www.thewallplapers.info, www.thewalllapers.info, www.thewallppers.info, www.thewallpaopers.info, www.thewallpopers.info, www.thewallpappers.info, www.thewallpppers.info, www.thewallpa9pers.info, www.thewallp9pers.info, www.thewallpapers.info, www.thewallppers.info, www.thewallpaipers.info, www.thewallpipers.info, www.thewallpaupers.info, www.thewallpupers.info, www.thewallpaers.info, www.thewallpapiers.info, www.thewallpaiers.info, www.thewallpapkers.info, www.thewallpakers.info, www.thewallpapuers.info, www.thewallpauers.info, www.thewallpapjers.info, www.thewallpajers.info, www.thewallpaplers.info, www.thewallpalers.info, www.thewallpaprs.info, www.thewallpapexrs.info, www.thewallpapxrs.info, www.thewallpapesrs.info, www.thewallpapsrs.info, www.thewallpapewrs.info, www.thewallpapwrs.info, www.thewallpaperrs.info, www.thewallpaprrs.info, www.thewallpapefrs.info, www.thewallpapfrs.info, www.thewallpapevrs.info, www.thewallpapvrs.info, www.thewallpapecrs.info, www.thewallpapcrs.info, www.thewallpapeqrs.info, www.thewallpapqrs.info, www.thewallpapears.info, www.thewallpapars.info, www.thewallpapeyrs.info, www.thewallpapyrs.info,

Other websites we recently analyzed

  1. Mamasita Bar & Grill
    Best Mexican Food in New York & Hell's Kitchen. Fresh Mexican food in 10019. Gluten free. No MSG, no Animal Fat, and no LARD.
    Scottsdale (United States) - 198.71.232.3
    Server software: DPS/0.2.7
    Technology: CSS, Html, Html5, Javascript
    Number of Javascript: 2
    Number of meta tags: 4
  2. sveltos.com
    Houston (United States) - 192.185.92.110
    Server software: nginx/1.10.0
    Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 6
    Number of meta tags: 5
  3. Ãœber uns | cairos-academy
    Germany - 78.47.220.105
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 1
  4. miscmannamagalginknimatnyasvetchargapoleaz
    San Francisco (United States) - 192.0.78.13
    Server software: nginx
    Technology: Skimlinks, CSS, Gravatar, Html, Html5, Javascript, Php, Pingback, Shortcodes, comScore, Wordpress, Twitter Button
    Number of Javascript: 8
    Number of meta tags: 7
  5. ¿Ã‹Ã‚¡ÍõվȺ ÁªÏµQQ£º1785605588
    Kansas City (United States) - 173.208.215.148
    Server software: Microsoft-IIS/6.0
    Technology: Html
    Number of meta tags: 1
  6. Restaurant La Ripaille
    Le restaurant La Ripaille est situé à Arromanches, nous vous proposons une cuisine Normande traditionnelle.
    France - 213.186.33.104
    G Analytics ID: UA-441859-8
    Server software: Apache
    Technology: Carousel, CSS, Html, Html5, Iframe, Javascript, Google Analytics
    Number of Javascript: 2
    Number of meta tags: 4
  7. Tennessee Career Centers
    Columbia (United States) - 66.211.30.3
    G Analytics ID: UA-39861102-1
    Server software:
    Technology: CSS, Html, Iframe, Javascript, Php, Swf Object, Google Analytics, Facebook Like box
    Number of Javascript: 4
    Number of meta tags: 1
  8. Home | Instant Spark
    Scottsdale (United States) - 173.201.243.1
    Server software: Apache
    Technology: Html
  9. Die Potsdam Lions
    Germany - 212.90.148.98
    Server software: Apache/2.2.31
    Technology: Html, Php
    Number of meta tags: 1
  10. Dorcas Clothing :: Wholesale Clothing
    Dorcas is a fashion wholesaler specializing in women's apparel located in Los Angeles fashion district. We offer the latest fashion at the best quality and price.
    Montréal (Canada) - 184.107.203.99
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery Cycle, jQuery UI, Lightbox, Php
    Number of Javascript: 10
    Number of meta tags: 10

Check Other Websites